Anti-WASF2

Artikelnummer: ATA-HPA045288
Artikelname: Anti-WASF2
Artikelnummer: ATA-HPA045288
Hersteller Artikelnummer: HPA045288
Alternativnummer: ATA-HPA045288-100,ATA-HPA045288-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: SCAR2, WAVE2
WAS protein family, member 2
Anti-WASF2
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 10163
UniProt: Q9Y6W5
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: DSASSPSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHPPPAP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: WASF2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane.
Immunohistochemistry analysis in human esophagus and liver tissues using Anti-WASF2 antibody. Corresponding WASF2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human esophagus shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
HPA045288-100ul
HPA045288-100ul
HPA045288-100ul