Anti-WASF2

Catalog Number: ATA-HPA045288
Article Name: Anti-WASF2
Biozol Catalog Number: ATA-HPA045288
Supplier Catalog Number: HPA045288
Alternative Catalog Number: ATA-HPA045288-100,ATA-HPA045288-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: SCAR2, WAVE2
WAS protein family, member 2
Anti-WASF2
Clonality: Polyclonal
Isotype: IgG
NCBI: 10163
UniProt: Q9Y6W5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DSASSPSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHPPPAP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: WASF2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane.
Immunohistochemistry analysis in human esophagus and liver tissues using Anti-WASF2 antibody. Corresponding WASF2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human esophagus shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
HPA045288-100ul
HPA045288-100ul
HPA045288-100ul