Anti-ARL6IP1
Artikelnummer:
ATA-HPA045307
- Bilder (7)
| Artikelname: | Anti-ARL6IP1 |
| Artikelnummer: | ATA-HPA045307 |
| Hersteller Artikelnummer: | HPA045307 |
| Alternativnummer: | ATA-HPA045307-100,ATA-HPA045307-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | AIP1, ARL6IP, ARMER, KIAA0069, SPG61 |
| ADP-ribosylation factor-like 6 interacting protein 1 |
| Anti-ARL6IP1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 23204 |
| UniProt: | Q15041 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | FGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ARL6IP1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human pancreas shows moderate to strong membranous positivity in exocrine glandular cells. |
|
|
HPA045307-100ul |
|
|
HPA045307-100ul |
|
|
HPA045307-100ul |
Produktgarantie und fachkundiger Support
