Anti-ARL6IP1
Catalog Number:
ATA-HPA045307
- Images (7)
| Article Name: | Anti-ARL6IP1 |
| Biozol Catalog Number: | ATA-HPA045307 |
| Supplier Catalog Number: | HPA045307 |
| Alternative Catalog Number: | ATA-HPA045307-100,ATA-HPA045307-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | AIP1, ARL6IP, ARMER, KIAA0069, SPG61 |
| ADP-ribosylation factor-like 6 interacting protein 1 |
| Anti-ARL6IP1 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 23204 |
| UniProt: | Q15041 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | FGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ARL6IP1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human pancreas shows moderate to strong membranous positivity in exocrine glandular cells. |
|
|
HPA045307-100ul |
|
|
HPA045307-100ul |
|
|
HPA045307-100ul |
Product Guarantee and Expert Support
