Anti-RSPH6A
Artikelnummer:
ATA-HPA045382
- Bilder (6)
| Artikelname: | Anti-RSPH6A |
| Artikelnummer: | ATA-HPA045382 |
| Hersteller Artikelnummer: | HPA045382 |
| Alternativnummer: | ATA-HPA045382-100,ATA-HPA045382-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | RSHL1, RSP4, RSP6, RSPH4B |
| radial spoke head 6 homolog A (Chlamydomonas) |
| Anti-RSPH6A |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 81492 |
| UniProt: | Q9H0K4 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LTTSLMLQRLQQGQSSLFQQLDPTFQEPPVNPLGQFNLYQTDQFSEGAQHGPYIRDDPALQFLPSELGFPHYSAQVP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | RSPH6A |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human testis and skeletal muscle tissues using HPA045382 antibody. Corresponding RSPH6A RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows moderate positivity in spermatocytes. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity as expected. |
|
|
HPA045382-100ul |
|
|
HPA045382-100ul |
|
|
HPA045382-100ul |
Produktgarantie und fachkundiger Support
