Anti-RSPH6A
Catalog Number:
ATA-HPA045382
- Images (6)
| Article Name: | Anti-RSPH6A |
| Biozol Catalog Number: | ATA-HPA045382 |
| Supplier Catalog Number: | HPA045382 |
| Alternative Catalog Number: | ATA-HPA045382-100,ATA-HPA045382-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | RSHL1, RSP4, RSP6, RSPH4B |
| radial spoke head 6 homolog A (Chlamydomonas) |
| Anti-RSPH6A |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 81492 |
| UniProt: | Q9H0K4 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LTTSLMLQRLQQGQSSLFQQLDPTFQEPPVNPLGQFNLYQTDQFSEGAQHGPYIRDDPALQFLPSELGFPHYSAQVP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | RSPH6A |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human testis and skeletal muscle tissues using HPA045382 antibody. Corresponding RSPH6A RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows moderate positivity in spermatocytes. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity as expected. |
|
|
HPA045382-100ul |
|
|
HPA045382-100ul |
|
|
HPA045382-100ul |
Product Guarantee and Expert Support
