Anti-C17orf62
Artikelnummer:
ATA-HPA045696
- Bilder (7)
| Artikelname: | Anti-C17orf62 |
| Artikelnummer: | ATA-HPA045696 |
| Hersteller Artikelnummer: | HPA045696 |
| Alternativnummer: | ATA-HPA045696-100,ATA-HPA045696-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ90469, MGC4368 |
| chromosome 17 open reading frame 62 |
| Anti-C17orf62 |
| Klonalität: | Polyclonal |
| Isotyp: | IgG |
| NCBI: | 79415 |
| UniProt: | Q9BQA9 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MVVLRLATGFSHPLTQSAVMGHRSDVEAIAKLITSFLELHCLESPTELSQSSDSEAGDPASQS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | C17orf62 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cell junctions. |
|
|
Immunohistochemical staining of human urinary bladder shows moderate cytoplasmic and membranous positivity in urothelial cells. |
|
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human Liver tissue |
|
|
HPA045696-100ul |
|
|
|
|
|
HPA045696-100ul |
|
|
HPA045696-100ul |
Produktgarantie und fachkundiger Support
