Anti-C17orf62
Catalog Number:
ATA-HPA045696
- Images (7)
| Article Name: | Anti-C17orf62 |
| Biozol Catalog Number: | ATA-HPA045696 |
| Supplier Catalog Number: | HPA045696 |
| Alternative Catalog Number: | ATA-HPA045696-100,ATA-HPA045696-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ90469, MGC4368 |
| chromosome 17 open reading frame 62 |
| Anti-C17orf62 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 79415 |
| UniProt: | Q9BQA9 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MVVLRLATGFSHPLTQSAVMGHRSDVEAIAKLITSFLELHCLESPTELSQSSDSEAGDPASQS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | C17orf62 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cell junctions. |
|
|
Immunohistochemical staining of human urinary bladder shows moderate cytoplasmic and membranous positivity in urothelial cells. |
|
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human Liver tissue |
|
|
HPA045696-100ul |
|
|
|
|
|
HPA045696-100ul |
|
|
HPA045696-100ul |
Product Guarantee and Expert Support
