Anti-SOX2 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA045725
Artikelname: Anti-SOX2 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA045725
Hersteller Artikelnummer: HPA045725
Alternativnummer: ATA-HPA045725-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ChIP, ICC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: Pan-Cancer
SRY (sex determining region Y)-box 2
Anti-SOX2
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 6657
UniProt: P48431
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSM
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SOX2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Western blot analysis in human cell line U-251 MG and human cell line HeLa.
HPA045725
HPA045725