Anti-SOX2 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA045725
Article Name: Anti-SOX2 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA045725
Supplier Catalog Number: HPA045725
Alternative Catalog Number: ATA-HPA045725-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ChIP, ICC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: Pan-Cancer
SRY (sex determining region Y)-box 2
Anti-SOX2
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 6657
UniProt: P48431
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSM
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SOX2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Western blot analysis in human cell line U-251 MG and human cell line HeLa.
HPA045725
HPA045725