Anti-SOX2 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-SOX2 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA045725
• Supplier Catalog Number: HPA045725
• Alternative Catalog Number: ATA-HPA045725-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ChIP, ICC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: Pan-Cancer

Product Description

SRY (sex determining region Y)-box 2

Additional Information

Anti-SOX2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 6657
• UniProt: P48431
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: GSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSM
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: SOX2
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.

Western blot analysis in human cell line U-251 MG and human cell line HeLa.

HPA045725

HPA045725