Anti-PPM1J
Artikelnummer:
ATA-HPA046045
- Bilder (6)
| Artikelname: | Anti-PPM1J |
| Artikelnummer: | ATA-HPA046045 |
| Hersteller Artikelnummer: | HPA046045 |
| Alternativnummer: | ATA-HPA046045-100,ATA-HPA046045-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DKFZp434P1514, FLJ35951, MGC19531, PP2Czeta, PPP2CZ |
| protein phosphatase, Mg2+/Mn2+ dependent, 1J |
| Anti-PPM1J |
| Klonalität: | Polyclonal |
| Isotyp: | IgG |
| NCBI: | 333926 |
| UniProt: | Q5JR12 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PEVRVYDLTQYEHCPDDVLVLGTDGLWDVTTDCEVAATVDRVLSAYEPNDHSRYTALAQALVLGARGTPRDRGWRLPNNKLGSGD |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PPM1J |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line MCF7 shows localization to vesicles. |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in Leydig cells and cells in seminiferous ducts. |
|
|
HPA046045-100ul |
|
|
|
|
|
HPA046045-100ul |
|
|
HPA046045-100ul |
Produktgarantie und fachkundiger Support
