Anti-PPM1J
Catalog Number:
ATA-HPA046045
- Images (6)
| Article Name: | Anti-PPM1J |
| Biozol Catalog Number: | ATA-HPA046045 |
| Supplier Catalog Number: | HPA046045 |
| Alternative Catalog Number: | ATA-HPA046045-100,ATA-HPA046045-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DKFZp434P1514, FLJ35951, MGC19531, PP2Czeta, PPP2CZ |
| protein phosphatase, Mg2+/Mn2+ dependent, 1J |
| Anti-PPM1J |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 333926 |
| UniProt: | Q5JR12 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PEVRVYDLTQYEHCPDDVLVLGTDGLWDVTTDCEVAATVDRVLSAYEPNDHSRYTALAQALVLGARGTPRDRGWRLPNNKLGSGD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PPM1J |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line MCF7 shows localization to vesicles. |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in Leydig cells and cells in seminiferous ducts. |
|
|
HPA046045-100ul |
|
|
|
|
|
HPA046045-100ul |
|
|
HPA046045-100ul |
Product Guarantee and Expert Support
