Anti-PMCH
Artikelnummer:
ATA-HPA046055
- Bilder (8)
| Artikelname: | Anti-PMCH |
| Artikelnummer: | ATA-HPA046055 |
| Hersteller Artikelnummer: | HPA046055 |
| Alternativnummer: | ATA-HPA046055-100,ATA-HPA046055-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human, Mouse |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MCH |
| pro-melanin-concentrating hormone |
| Anti-PMCH |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5367 |
| UniProt: | P20382 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SIRNLDDDMVFNTFRLGKGFQKEDTAEKSVIAPSLEQYKNDESSFMNEEENKVSKNTGSKHN |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PMCH |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemical staining of human colon, hypothalamus, liver and testis using Anti-PMCH antibody HPA046055 (A) shows similar protein distribution across tissues to independent antibody HPA061884 (B). |
|
|
Immunohistochemical staining of human hypothalamus using Anti-PMCH antibody HPA046055. |
|
|
Immunohistochemical staining of human liver using Anti-PMCH antibody HPA046055. |
|
|
Immunohistochemical staining of human colon using Anti-PMCH antibody HPA046055. |
|
|
Immunohistochemical staining of human testis using Anti-PMCH antibody HPA046055. |
|
|
HPA046055-100ul |
|
|
HPA046055-100ul |
|
|
HPA046055-100ul |
Produktgarantie und fachkundiger Support
