Anti-PMCH
Catalog Number:
ATA-HPA046055
- Images (8)
| Article Name: | Anti-PMCH |
| Biozol Catalog Number: | ATA-HPA046055 |
| Supplier Catalog Number: | HPA046055 |
| Alternative Catalog Number: | ATA-HPA046055-100,ATA-HPA046055-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human, Mouse |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | MCH |
| pro-melanin-concentrating hormone |
| Anti-PMCH |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 5367 |
| UniProt: | P20382 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SIRNLDDDMVFNTFRLGKGFQKEDTAEKSVIAPSLEQYKNDESSFMNEEENKVSKNTGSKHN |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PMCH |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemical staining of human colon, hypothalamus, liver and testis using Anti-PMCH antibody HPA046055 (A) shows similar protein distribution across tissues to independent antibody HPA061884 (B). |
|
|
Immunohistochemical staining of human hypothalamus using Anti-PMCH antibody HPA046055. |
|
|
Immunohistochemical staining of human liver using Anti-PMCH antibody HPA046055. |
|
|
Immunohistochemical staining of human colon using Anti-PMCH antibody HPA046055. |
|
|
Immunohistochemical staining of human testis using Anti-PMCH antibody HPA046055. |
|
|
HPA046055-100ul |
|
|
HPA046055-100ul |
|
|
HPA046055-100ul |
Product Guarantee and Expert Support
