Anti-SLC28A2

Artikelnummer: ATA-HPA046068
Artikelname: Anti-SLC28A2
Artikelnummer: ATA-HPA046068
Hersteller Artikelnummer: HPA046068
Alternativnummer: ATA-HPA046068-100,ATA-HPA046068-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CNT2, HCNT2, HsT17153, SPNT1
solute carrier family 28 (concentrative nucleoside transporter), member 2
Anti-SLC28A2
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 9153
UniProt: O43868
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: MEKASGRQSIALSTVETGTVNLGLELMEKEVEPEGSKRTDAQGHSLGDGLGPSTYQRRSRWPFSKARSFCKTHASLFKK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SLC28A2
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:1000 - 1:2500
Immunohistochemistry analysis in human small intestine and liver tissues using Anti-SLC28A2 antibody. Corresponding SLC28A2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human colon, liver, lymph node and small intestine using Anti-SLC28A2 antibody HPA046068 (A) shows similar protein distribution across tissues to independent antibody HPA055623 (B).
Immunohistochemical staining of human small intestine shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
Immunohistochemical staining of human colon using Anti-SLC28A2 antibody HPA046068.
Immunohistochemical staining of human lymph node using Anti-SLC28A2 antibody HPA046068.
HPA046068-100ul
HPA046068-100ul
HPA046068-100ul