Anti-SLC28A2

Product Overview

• Article Name: Anti-SLC28A2
• Biozol Catalog Number: ATA-HPA046068
• Supplier Catalog Number: HPA046068
• Alternative Catalog Number: ATA-HPA046068-100,ATA-HPA046068-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CNT2, HCNT2, HsT17153, SPNT1

Product Description

solute carrier family 28 (concentrative nucleoside transporter), member 2

Additional Information

Anti-SLC28A2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2 mg/ml
• Isotype: IgG
• NCBI: 9153
• UniProt: O43868
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: MEKASGRQSIALSTVETGTVNLGLELMEKEVEPEGSKRTDAQGHSLGDGLGPSTYQRRSRWPFSKARSFCKTHASLFKK
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: SLC28A2
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:1000 - 1:2500

Images

Immunohistochemistry analysis in human small intestine and liver tissues using Anti-SLC28A2 antibody. Corresponding SLC28A2 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human colon, liver, lymph node and small intestine using Anti-SLC28A2 antibody HPA046068 (A) shows similar protein distribution across tissues to independent antibody HPA055623 (B).

Immunohistochemical staining of human small intestine shows high expression.

Immunohistochemical staining of human liver shows low expression as expected.

Immunohistochemical staining of human colon using Anti-SLC28A2 antibody HPA046068.

Immunohistochemical staining of human lymph node using Anti-SLC28A2 antibody HPA046068.

HPA046068-100ul

HPA046068-100ul

HPA046068-100ul