Anti-SKOR2
Artikelnummer:
ATA-HPA046206
- Bilder (7)
| Artikelname: | Anti-SKOR2 |
| Artikelnummer: | ATA-HPA046206 |
| Hersteller Artikelnummer: | HPA046206 |
| Alternativnummer: | ATA-HPA046206-100,ATA-HPA046206-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Mouse |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CORL2, Fussel-18, FUSSEL18 |
| SKI family transcriptional corepressor 2 |
| Anti-SKOR2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 652991 |
| UniProt: | Q2VWA4 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MASSPLPGPNDILLASPSSAFQPDTLSQPRPGHANLKPNQVGQVILYGIPIVS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SKOR2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemical staining of mouse embryo E11 shows strong nuclear positivity in the developing cerebellum. |
|
|
Immunohistochemical staining of mouse epididymis shows strong nuclear positivity in spermatozoa. |
|
|
Immunohistochemical staining of mouse cerebellum shows strong nuclear positivity in Purkinje cells. |
|
|
Immunohistochemical staining of mouse heart shows no positivity in cardiomyocytes as expected. |
|
|
HPA046206-100ul |
|
|
HPA046206-100ul |
|
|
HPA046206-100ul |
Produktgarantie und fachkundiger Support
