Anti-SKOR2
Catalog Number:
ATA-HPA046206
- Images (7)
| Article Name: | Anti-SKOR2 |
| Biozol Catalog Number: | ATA-HPA046206 |
| Supplier Catalog Number: | HPA046206 |
| Alternative Catalog Number: | ATA-HPA046206-100,ATA-HPA046206-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Mouse |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CORL2, Fussel-18, FUSSEL18 |
| SKI family transcriptional corepressor 2 |
| Anti-SKOR2 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 652991 |
| UniProt: | Q2VWA4 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MASSPLPGPNDILLASPSSAFQPDTLSQPRPGHANLKPNQVGQVILYGIPIVS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SKOR2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemical staining of mouse embryo E11 shows strong nuclear positivity in the developing cerebellum. |
|
|
Immunohistochemical staining of mouse epididymis shows strong nuclear positivity in spermatozoa. |
|
|
Immunohistochemical staining of mouse cerebellum shows strong nuclear positivity in Purkinje cells. |
|
|
Immunohistochemical staining of mouse heart shows no positivity in cardiomyocytes as expected. |
|
|
HPA046206-100ul |
|
|
HPA046206-100ul |
|
|
HPA046206-100ul |
Product Guarantee and Expert Support
