Anti-NRIP1
Artikelnummer:
ATA-HPA046571
- Bilder (7)
| Artikelname: | Anti-NRIP1 |
| Artikelnummer: | ATA-HPA046571 |
| Hersteller Artikelnummer: | HPA046571 |
| Alternativnummer: | ATA-HPA046571-100,ATA-HPA046571-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | RIP140 |
| nuclear receptor interacting protein 1 |
| Anti-NRIP1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 8204 |
| UniProt: | P48552 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SSEAHLQQYSREHALKTQNANQAASERLAAMARLQENGQKDVGSYQLPKGMSSHLNGQARTSSSKLMASKSSATVFQNPMGIIPSSPKNAGYKNSLERNNIKQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | NRIP1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemical staining of human Fallopian tube shows moderate nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human duodenum shows moderate nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human cerebellum shows moderate nuclear positivity in cells in granular layer. |
|
|
Immunohistochemical staining of human skeletal muscle shows weak nuclear positivity in myocytes. |
|
|
HPA046571-100ul |
|
|
HPA046571-100ul |
|
|
HPA046571-100ul |
Produktgarantie und fachkundiger Support
