Anti-NRIP1
Catalog Number:
ATA-HPA046571
- Images (7)
| Article Name: | Anti-NRIP1 |
| Biozol Catalog Number: | ATA-HPA046571 |
| Supplier Catalog Number: | HPA046571 |
| Alternative Catalog Number: | ATA-HPA046571-100,ATA-HPA046571-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | RIP140 |
| nuclear receptor interacting protein 1 |
| Anti-NRIP1 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 8204 |
| UniProt: | P48552 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SSEAHLQQYSREHALKTQNANQAASERLAAMARLQENGQKDVGSYQLPKGMSSHLNGQARTSSSKLMASKSSATVFQNPMGIIPSSPKNAGYKNSLERNNIKQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | NRIP1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemical staining of human Fallopian tube shows moderate nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human duodenum shows moderate nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human cerebellum shows moderate nuclear positivity in cells in granular layer. |
|
|
Immunohistochemical staining of human skeletal muscle shows weak nuclear positivity in myocytes. |
|
|
HPA046571-100ul |
|
|
HPA046571-100ul |
|
|
HPA046571-100ul |
Product Guarantee and Expert Support
