Anti-RASL10B
Artikelnummer:
ATA-HPA046842
- Bilder (6)
| Artikelname: | Anti-RASL10B |
| Artikelnummer: | ATA-HPA046842 |
| Hersteller Artikelnummer: | HPA046842 |
| Alternativnummer: | ATA-HPA046842-100,ATA-HPA046842-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | RRP17, VTS58635 |
| RAS-like, family 10, member B |
| Anti-RASL10B |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 91608 |
| UniProt: | Q96S79 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | NTLQEWADTCCRGLRSVHAYILVYDICCFDSFEYVKTIRQQILETRVIGTSETPIIIVGNKRDL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | RASL10B |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemistry analysis in human skeletal muscle and tonsil tissues using Anti-RASL10B antibody. Corresponding RASL10B RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human skeletal muscle shows high expression. |
|
|
Immunohistochemical staining of human tonsil shows low expression as expected. |
|
|
HPA046842-100ul |
|
|
HPA046842-100ul |
|
|
HPA046842-100ul |
Produktgarantie und fachkundiger Support
