Anti-RASL10B

Catalog Number: ATA-HPA046842
Article Name: Anti-RASL10B
Biozol Catalog Number: ATA-HPA046842
Supplier Catalog Number: HPA046842
Alternative Catalog Number: ATA-HPA046842-100,ATA-HPA046842-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: RRP17, VTS58635
RAS-like, family 10, member B
Anti-RASL10B
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 91608
UniProt: Q96S79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NTLQEWADTCCRGLRSVHAYILVYDICCFDSFEYVKTIRQQILETRVIGTSETPIIIVGNKRDL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RASL10B
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50
Immunohistochemistry analysis in human skeletal muscle and tonsil tissues using Anti-RASL10B antibody. Corresponding RASL10B RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human skeletal muscle shows high expression.
Immunohistochemical staining of human tonsil shows low expression as expected.
HPA046842-100ul
HPA046842-100ul
HPA046842-100ul