Anti-FAM89B
Artikelnummer:
ATA-HPA046895
- Bilder (6)
| Artikelname: | Anti-FAM89B |
| Artikelnummer: | ATA-HPA046895 |
| Hersteller Artikelnummer: | HPA046895 |
| Alternativnummer: | ATA-HPA046895-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FAM89B |
| family with sequence similarity 89, member B |
| Anti-FAM89B |
| Klonalität: | Polyclonal |
| Isotyp: | IgG |
| NCBI: | 23625 |
| UniProt: | Q8N5H3 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RKEMLWGLYESIQDYKHLCQDLSFCQDLSSSLHSDSSYPPDAGLS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | FAM89B |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in renal tubules. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and FAM89B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407290). |
|
|
|
|
|
HPA046895-100ul |
|
|
HPA046895-100ul |
|
|
HPA046895-100ul |
Produktgarantie und fachkundiger Support
