Anti-FAM89B
Catalog Number:
ATA-HPA046895
- Images (6)
| Article Name: | Anti-FAM89B |
| Biozol Catalog Number: | ATA-HPA046895 |
| Supplier Catalog Number: | HPA046895 |
| Alternative Catalog Number: | ATA-HPA046895-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FAM89B |
| family with sequence similarity 89, member B |
| Anti-FAM89B |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 23625 |
| UniProt: | Q8N5H3 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RKEMLWGLYESIQDYKHLCQDLSFCQDLSSSLHSDSSYPPDAGLS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | FAM89B |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in renal tubules. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and FAM89B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407290). |
|
|
|
|
|
HPA046895-100ul |
|
|
HPA046895-100ul |
|
|
HPA046895-100ul |
Product Guarantee and Expert Support
