Anti-LGALS9
Artikelnummer:
ATA-HPA047218
- Bilder (9)
| Artikelname: | Anti-LGALS9 |
| Artikelnummer: | ATA-HPA047218 |
| Hersteller Artikelnummer: | HPA047218 |
| Alternativnummer: | ATA-HPA047218-100,ATA-HPA047218-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | LGALS9A |
| lectin, galactoside-binding, soluble, 9 |
| Anti-LGALS9 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 3965 |
| UniProt: | O00182 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTIN |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | LGALS9 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human rectum and skeletal muscle tissues using HPA047218 antibody. Corresponding LGALS9 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in non - germinal center cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes. |
|
|
HPA047218-100ul |
|
|
|
|
|
HPA047218-100ul |
|
|
HPA047218-100ul |
Produktgarantie und fachkundiger Support
