Anti-LGALS9
Catalog Number:
ATA-HPA047218
- Images (9)
| Article Name: | Anti-LGALS9 |
| Biozol Catalog Number: | ATA-HPA047218 |
| Supplier Catalog Number: | HPA047218 |
| Alternative Catalog Number: | ATA-HPA047218-100,ATA-HPA047218-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | LGALS9A |
| lectin, galactoside-binding, soluble, 9 |
| Anti-LGALS9 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 3965 |
| UniProt: | O00182 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTIN |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | LGALS9 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human rectum and skeletal muscle tissues using HPA047218 antibody. Corresponding LGALS9 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in non - germinal center cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes. |
|
|
HPA047218-100ul |
|
|
|
|
|
HPA047218-100ul |
|
|
HPA047218-100ul |
Product Guarantee and Expert Support
