Anti-RPL21
Artikelnummer:
ATA-HPA047252
- Bilder (6)
| Artikelname: | Anti-RPL21 |
| Artikelnummer: | ATA-HPA047252 |
| Hersteller Artikelnummer: | HPA047252 |
| Alternativnummer: | ATA-HPA047252-100,ATA-HPA047252-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DKFZp686C06101, FLJ27458, L21, MGC104274, MGC104275, MGC71252 |
| ribosomal protein L21 |
| Anti-RPL21 |
| Klonalität: | Polyclonal |
| Isotyp: | IgG |
| NCBI: | 6144 |
| UniProt: | P46778 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RGTRYMFSRPFRKHGVVPLATYMRIYKKGD |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | RPL21 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50 |
|
|
Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoli fibrillar center, cytosol & endoplasmic reticulum. |
|
|
Immunohistochemical staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells. |
|
|
|
|
|
HPA047252-100ul |
|
|
HPA047252-100ul |
|
|
HPA047252-100ul |
Produktgarantie und fachkundiger Support
