Anti-RPL21
Catalog Number:
ATA-HPA047252
- Images (6)
| Article Name: | Anti-RPL21 |
| Biozol Catalog Number: | ATA-HPA047252 |
| Supplier Catalog Number: | HPA047252 |
| Alternative Catalog Number: | ATA-HPA047252-100,ATA-HPA047252-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DKFZp686C06101, FLJ27458, L21, MGC104274, MGC104275, MGC71252 |
| ribosomal protein L21 |
| Anti-RPL21 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 6144 |
| UniProt: | P46778 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RGTRYMFSRPFRKHGVVPLATYMRIYKKGD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | RPL21 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50 |
|
|
Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoli fibrillar center, cytosol & endoplasmic reticulum. |
|
|
Immunohistochemical staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells. |
|
|
|
|
|
HPA047252-100ul |
|
|
HPA047252-100ul |
|
|
HPA047252-100ul |
Product Guarantee and Expert Support
