Anti-SLC23A1
Artikelnummer:
ATA-HPA047612
- Bilder (8)
| Artikelname: | Anti-SLC23A1 |
| Artikelnummer: | ATA-HPA047612 |
| Hersteller Artikelnummer: | HPA047612 |
| Alternativnummer: | ATA-HPA047612-100,ATA-HPA047612-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | SLC23A2, SVCT1, YSPL3 |
| solute carrier family 23 (ascorbic acid transporter), member 1 |
| Anti-SLC23A1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 9963 |
| UniProt: | Q9UHI7 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | NTVPGSPEERGLIQWKAGAHANSDMSSSLKSYDFPIGMGIVKRITFLKYIPICPVFKGFSSSSKDQIAIPEDTPENTETAS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SLC23A1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human small intestine and pancreas tissues using HPA047612 antibody. Corresponding SLC23A1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong positivity in apical membrane in cells in tubules. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate to strong positivity in apical membrane of ciliated cells. |
|
|
Immunohistochemical staining of human small intestine shows strong positivity in luminal membrane in glandular cells. |
|
|
Immunohistochemical staining of human pancreas shows no positivity as expected. |
|
|
HPA047612-100ul |
|
|
HPA047612-100ul |
|
|
HPA047612-100ul |
Produktgarantie und fachkundiger Support
