Anti-SLC23A1
Catalog Number:
ATA-HPA047612
- Images (8)
| Article Name: | Anti-SLC23A1 |
| Biozol Catalog Number: | ATA-HPA047612 |
| Supplier Catalog Number: | HPA047612 |
| Alternative Catalog Number: | ATA-HPA047612-100,ATA-HPA047612-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | SLC23A2, SVCT1, YSPL3 |
| solute carrier family 23 (ascorbic acid transporter), member 1 |
| Anti-SLC23A1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 9963 |
| UniProt: | Q9UHI7 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | NTVPGSPEERGLIQWKAGAHANSDMSSSLKSYDFPIGMGIVKRITFLKYIPICPVFKGFSSSSKDQIAIPEDTPENTETAS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SLC23A1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human small intestine and pancreas tissues using HPA047612 antibody. Corresponding SLC23A1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong positivity in apical membrane in cells in tubules. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate to strong positivity in apical membrane of ciliated cells. |
|
|
Immunohistochemical staining of human small intestine shows strong positivity in luminal membrane in glandular cells. |
|
|
Immunohistochemical staining of human pancreas shows no positivity as expected. |
|
|
HPA047612-100ul |
|
|
HPA047612-100ul |
|
|
HPA047612-100ul |
Product Guarantee and Expert Support
