Anti-GKN1
Artikelnummer:
ATA-HPA047684
- Bilder (8)
| Artikelname: | Anti-GKN1 |
| Artikelnummer: | ATA-HPA047684 |
| Hersteller Artikelnummer: | HPA047684 |
| Alternativnummer: | ATA-HPA047684-100,ATA-HPA047684-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | AMP18, BRICD1, CA11 |
| gastrokine 1 |
| Anti-GKN1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 56287 |
| UniProt: | Q9NS71 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | NDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | GKN1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human stomach and testis tissues using HPA047684 antibody. Corresponding GKN1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human kidney shows no positivity in cells in tubules as expected. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
Immunohistochemical staining of human stomach shows moderate to strong positivity in mucus in glandular cells. |
|
|
Immunohistochemical staining of human testis shows no positivity in cells in seminiferous ducts as expected. |
|
|
HPA047684-100ul |
|
|
HPA047684-100ul |
|
|
HPA047684-100ul |
Produktgarantie und fachkundiger Support
