Anti-GKN1
Catalog Number:
ATA-HPA047684
- Images (8)
| Article Name: | Anti-GKN1 |
| Biozol Catalog Number: | ATA-HPA047684 |
| Supplier Catalog Number: | HPA047684 |
| Alternative Catalog Number: | ATA-HPA047684-100,ATA-HPA047684-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | AMP18, BRICD1, CA11 |
| gastrokine 1 |
| Anti-GKN1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 56287 |
| UniProt: | Q9NS71 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | NDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | GKN1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human stomach and testis tissues using HPA047684 antibody. Corresponding GKN1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human kidney shows no positivity in cells in tubules as expected. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
Immunohistochemical staining of human stomach shows moderate to strong positivity in mucus in glandular cells. |
|
|
Immunohistochemical staining of human testis shows no positivity in cells in seminiferous ducts as expected. |
|
|
HPA047684-100ul |
|
|
HPA047684-100ul |
|
|
HPA047684-100ul |
Product Guarantee and Expert Support
