Anti-ZC3HAV1
Artikelnummer:
ATA-HPA047818
- Bilder (6)
| Artikelname: | Anti-ZC3HAV1 |
| Artikelnummer: | ATA-HPA047818 |
| Hersteller Artikelnummer: | HPA047818 |
| Alternativnummer: | ATA-HPA047818-100,ATA-HPA047818-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLB6421, FLJ13288, MGC48898, PARP13, ZAP, ZC3H2, ZC3HDC2 |
| zinc finger CCCH-type, antiviral 1 |
| Anti-ZC3HAV1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 56829 |
| UniProt: | Q7Z2W4 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | NGKSGTQDIQPGPLFNNNADGVATDITSTRSLNYKSTSSGHREISSPRIQDAGPASRDVQATGRIADDADPRVALVNDSLSDVTSTTSSRVDDHDSEEICLDHL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ZC3HAV1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & the Golgi apparatus. |
|
|
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts. |
|
|
HPA047818-100ul |
|
|
|
|
|
HPA047818-100ul |
|
|
HPA047818-100ul |
Produktgarantie und fachkundiger Support
