Anti-ZC3HAV1
Catalog Number:
ATA-HPA047818
- Images (6)
| Article Name: | Anti-ZC3HAV1 |
| Biozol Catalog Number: | ATA-HPA047818 |
| Supplier Catalog Number: | HPA047818 |
| Alternative Catalog Number: | ATA-HPA047818-100,ATA-HPA047818-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLB6421, FLJ13288, MGC48898, PARP13, ZAP, ZC3H2, ZC3HDC2 |
| zinc finger CCCH-type, antiviral 1 |
| Anti-ZC3HAV1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 56829 |
| UniProt: | Q7Z2W4 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | NGKSGTQDIQPGPLFNNNADGVATDITSTRSLNYKSTSSGHREISSPRIQDAGPASRDVQATGRIADDADPRVALVNDSLSDVTSTTSSRVDDHDSEEICLDHL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ZC3HAV1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & the Golgi apparatus. |
|
|
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts. |
|
|
HPA047818-100ul |
|
|
|
|
|
HPA047818-100ul |
|
|
HPA047818-100ul |
Product Guarantee and Expert Support
