Anti-PPP1R17
Artikelnummer:
ATA-HPA047819
- Bilder (9)
| Artikelname: | Anti-PPP1R17 |
| Artikelnummer: | ATA-HPA047819 |
| Hersteller Artikelnummer: | HPA047819 |
| Alternativnummer: | ATA-HPA047819-100,ATA-HPA047819-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C7orf16, GSBS |
| protein phosphatase 1, regulatory subunit 17 |
| Anti-PPP1R17 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 10842 |
| UniProt: | O96001 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | DRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPALH |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PPP1R17 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human cerebellum shows moderate to strong positivity in Purkinje cells. |
|
|
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human placenta shows no positivity in trophoblastic cells as expected. |
|
|
HPA047819-100ul |
|
|
|
|
|
|
|
|
HPA047819-100ul |
|
|
HPA047819-100ul |
Produktgarantie und fachkundiger Support
