Anti-PPP1R17
Catalog Number:
ATA-HPA047819
- Images (9)
| Article Name: | Anti-PPP1R17 |
| Biozol Catalog Number: | ATA-HPA047819 |
| Supplier Catalog Number: | HPA047819 |
| Alternative Catalog Number: | ATA-HPA047819-100,ATA-HPA047819-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C7orf16, GSBS |
| protein phosphatase 1, regulatory subunit 17 |
| Anti-PPP1R17 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 10842 |
| UniProt: | O96001 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | DRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPALH |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PPP1R17 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human cerebellum shows moderate to strong positivity in Purkinje cells. |
|
|
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human placenta shows no positivity in trophoblastic cells as expected. |
|
|
HPA047819-100ul |
|
|
|
|
|
|
|
|
HPA047819-100ul |
|
|
HPA047819-100ul |
Product Guarantee and Expert Support
