Anti-LMNB2
Artikelnummer:
ATA-HPA047863
- Bilder (8)
| Artikelname: | Anti-LMNB2 |
| Artikelnummer: | ATA-HPA047863 |
| Hersteller Artikelnummer: | HPA047863 |
| Alternativnummer: | ATA-HPA047863-100,ATA-HPA047863-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | LMN2 |
| lamin B2 |
| Anti-LMNB2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Isotyp: | IgG |
| NCBI: | 84823 |
| UniProt: | Q03252 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | DEVNKSAKKREGELTVAQGRVKDLESLFHRSEVELAAALSDKRGLESDVAELRAQLAKAEDGHAVAKKQLEKETLM |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | LMNB2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:5000 - 1:10000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human cerebral cortex and liver tissues using Anti-LMNB2 antibody. Corresponding LMNB2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Immunohistochemical staining of human cerebral cortex shows high expression. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG Lane 4: Human plasma Lane 5: Human Liver tissue Lane 6: Human Tonsil tissue |
|
|
HPA047863 |
|
|
HPA047863-100ul |
|
|
HPA047863-100ul |
|
|
HPA047863-100ul |
Produktgarantie und fachkundiger Support
