Anti-LMNB2

Catalog Number: ATA-HPA047863
Article Name: Anti-LMNB2
Biozol Catalog Number: ATA-HPA047863
Supplier Catalog Number: HPA047863
Alternative Catalog Number: ATA-HPA047863-100,ATA-HPA047863-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: LMN2
lamin B2
Anti-LMNB2
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Isotype: IgG
NCBI: 84823
UniProt: Q03252
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DEVNKSAKKREGELTVAQGRVKDLESLFHRSEVELAAALSDKRGLESDVAELRAQLAKAEDGHAVAKKQLEKETLM
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: LMNB2
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:5000 - 1:10000, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human cerebral cortex and liver tissues using Anti-LMNB2 antibody. Corresponding LMNB2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human liver shows low expression as expected.
Immunohistochemical staining of human cerebral cortex shows high expression.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251 MG
Lane 4: Human plasma
Lane 5: Human Liver tissue
Lane 6: Human Tonsil tissue
HPA047863
HPA047863-100ul
HPA047863-100ul
HPA047863-100ul