Anti-ACSS3
Artikelnummer:
ATA-HPA047956
- Bilder (6)
| Artikelname: | Anti-ACSS3 |
| Artikelnummer: | ATA-HPA047956 |
| Hersteller Artikelnummer: | HPA047956 |
| Alternativnummer: | ATA-HPA047956-100,ATA-HPA047956-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ21963 |
| acyl-CoA synthetase short-chain family member 3 |
| Anti-ACSS3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 79611 |
| UniProt: | Q9H6R3 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | ASKELSSRIDHVKPKVVVTASFGIEPGRRVEYVPLVEEALKIGQHKPDKILIYNRPNMEAVPLAPGRDLDWDEEMAKAQSHDCVPVLSEHPLYIL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ACSS3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules. |
|
|
Western blot analysis using Anti-ACSS3 antibody HPA047956 (A) shows similar pattern to independent antibody HPA039353 (B). |
|
|
HPA047956-100ul |
|
|
|
|
|
HPA047956-100ul |
|
|
HPA047956-100ul |
Produktgarantie und fachkundiger Support
