Anti-ACSS3
Catalog Number:
ATA-HPA047956
- Images (6)
| Article Name: | Anti-ACSS3 |
| Biozol Catalog Number: | ATA-HPA047956 |
| Supplier Catalog Number: | HPA047956 |
| Alternative Catalog Number: | ATA-HPA047956-100,ATA-HPA047956-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ21963 |
| acyl-CoA synthetase short-chain family member 3 |
| Anti-ACSS3 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 79611 |
| UniProt: | Q9H6R3 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | ASKELSSRIDHVKPKVVVTASFGIEPGRRVEYVPLVEEALKIGQHKPDKILIYNRPNMEAVPLAPGRDLDWDEEMAKAQSHDCVPVLSEHPLYIL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ACSS3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules. |
|
|
Western blot analysis using Anti-ACSS3 antibody HPA047956 (A) shows similar pattern to independent antibody HPA039353 (B). |
|
|
HPA047956-100ul |
|
|
|
|
|
HPA047956-100ul |
|
|
HPA047956-100ul |
Product Guarantee and Expert Support
