Anti-FCRL3
Artikelnummer:
ATA-HPA048022
- Bilder (7)
| Artikelname: | Anti-FCRL3 |
| Artikelnummer: | ATA-HPA048022 |
| Hersteller Artikelnummer: | HPA048022 |
| Alternativnummer: | ATA-HPA048022-100,ATA-HPA048022-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CD307c, FCRH3, IFGP3, IRTA3, SPAP2, SPAP2a, SPAP2b, SPAP2c, SPAP2d, SPAP2e |
| Fc receptor like 3 |
| Anti-FCRL3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 115352 |
| UniProt: | Q96P31 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | AQGDTYWYHDEKLLKIKHDKIQITEPGNYQCKTRGSSLSDAVHVEFSPDWLILQALHPVFEGDNVILRCQGKDNKNTHQKVYYKDGKQLPNSYNLEKITVNSVSRDNSKYHCTAYRKFYILDIEVTSKPLNIQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | FCRL3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human tonsil and cerebral cortex tissues using HPA048022 antibody. Corresponding FCRL3 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human tonsil shows positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human small intestine shows moderate cytoplasmic positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows no positivity as expected. |
|
|
HPA048022-100ul |
|
|
HPA048022-100ul |
|
|
HPA048022-100ul |
Produktgarantie und fachkundiger Support
