Anti-FCRL3
Catalog Number:
ATA-HPA048022
- Images (7)
| Article Name: | Anti-FCRL3 |
| Biozol Catalog Number: | ATA-HPA048022 |
| Supplier Catalog Number: | HPA048022 |
| Alternative Catalog Number: | ATA-HPA048022-100,ATA-HPA048022-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CD307c, FCRH3, IFGP3, IRTA3, SPAP2, SPAP2a, SPAP2b, SPAP2c, SPAP2d, SPAP2e |
| Fc receptor like 3 |
| Anti-FCRL3 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 115352 |
| UniProt: | Q96P31 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | AQGDTYWYHDEKLLKIKHDKIQITEPGNYQCKTRGSSLSDAVHVEFSPDWLILQALHPVFEGDNVILRCQGKDNKNTHQKVYYKDGKQLPNSYNLEKITVNSVSRDNSKYHCTAYRKFYILDIEVTSKPLNIQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | FCRL3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human tonsil and cerebral cortex tissues using HPA048022 antibody. Corresponding FCRL3 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human tonsil shows positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human small intestine shows moderate cytoplasmic positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows no positivity as expected. |
|
|
HPA048022-100ul |
|
|
HPA048022-100ul |
|
|
HPA048022-100ul |
Product Guarantee and Expert Support
