Anti-SIRPB2
Artikelnummer:
ATA-HPA048032
- Bilder (9)
| Artikelname: | Anti-SIRPB2 |
| Artikelnummer: | ATA-HPA048032 |
| Hersteller Artikelnummer: | HPA048032 |
| Alternativnummer: | ATA-HPA048032-100,ATA-HPA048032-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | dJ776F14.2, PTPN1L, PTPNS1L3 |
| signal-regulatory protein beta 2 |
| Anti-SIRPB2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 284759 |
| UniProt: | Q5JXA9 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | GETLLLRCMVVGSCTDGMIKWVKVSTQDQQEIYNFKRGSFPGVMPMIQRTSEPLNCDYSIYIHNVTREHTGTYHCVRFDGLSEHSEMKSDEGTSVLVKGAGDPEPDLWIIQPQELVLGTTGDTVFLNCTV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SIRPB2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nuclear bodies. |
|
|
Immunohistochemical staining of human placenta shows weak to moderate membranous positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human lymph node shows moderate to strong membranous positivity in germinal center cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate to strong membranous positivity in endothelial cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
HPA048032-100ul |
|
|
|
|
|
HPA048032-100ul |
|
|
HPA048032-100ul |
Produktgarantie und fachkundiger Support
