Anti-SIRPB2
Catalog Number:
ATA-HPA048032
- Images (9)
| Article Name: | Anti-SIRPB2 |
| Biozol Catalog Number: | ATA-HPA048032 |
| Supplier Catalog Number: | HPA048032 |
| Alternative Catalog Number: | ATA-HPA048032-100,ATA-HPA048032-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | dJ776F14.2, PTPN1L, PTPNS1L3 |
| signal-regulatory protein beta 2 |
| Anti-SIRPB2 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 284759 |
| UniProt: | Q5JXA9 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GETLLLRCMVVGSCTDGMIKWVKVSTQDQQEIYNFKRGSFPGVMPMIQRTSEPLNCDYSIYIHNVTREHTGTYHCVRFDGLSEHSEMKSDEGTSVLVKGAGDPEPDLWIIQPQELVLGTTGDTVFLNCTV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SIRPB2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nuclear bodies. |
|
|
Immunohistochemical staining of human placenta shows weak to moderate membranous positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human lymph node shows moderate to strong membranous positivity in germinal center cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate to strong membranous positivity in endothelial cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
HPA048032-100ul |
|
|
|
|
|
HPA048032-100ul |
|
|
HPA048032-100ul |
Product Guarantee and Expert Support
