Anti-SLC9A1

Artikelnummer: ATA-HPA048532
Artikelname: Anti-SLC9A1
Artikelnummer: ATA-HPA048532
Hersteller Artikelnummer: HPA048532
Alternativnummer: ATA-HPA048532-100,ATA-HPA048532-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: APNH, NHE1, PPP1R143
solute carrier family 9, subfamily A (NHE1, cation proton antiporter 1), member 1
Anti-SLC9A1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 6548
UniProt: P19634
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: KILRNNLQKTRQRLRSYNRHTLVADPYEEAWNQMLLRRQKARQLEQKINNYLTVPAHKLDSPTMSRARIGSDPLAYEPKEDLPVITIDPA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SLC9A1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human stomach and liver tissues using Anti-SLC9A1 antibody. Corresponding SLC9A1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, kidney, liver and stomach using Anti-SLC9A1 antibody HPA048532 (A) shows similar protein distribution across tissues to independent antibody HPA052891 (B).
Immunohistochemical staining of human stomach shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
Immunohistochemical staining of human kidney using Anti-SLC9A1 antibody HPA048532.
Immunohistochemical staining of human cerebral cortex using Anti-SLC9A1 antibody HPA048532.
HPA048532-100ul
HPA048532-100ul
HPA048532-100ul