Anti-SLC9A1

Product Overview

• Article Name: Anti-SLC9A1
• Biozol Catalog Number: ATA-HPA048532
• Supplier Catalog Number: HPA048532
• Alternative Catalog Number: ATA-HPA048532-100,ATA-HPA048532-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: APNH, NHE1, PPP1R143

Product Description

solute carrier family 9, subfamily A (NHE1, cation proton antiporter 1), member 1

Additional Information

Anti-SLC9A1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 6548
• UniProt: P19634
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: KILRNNLQKTRQRLRSYNRHTLVADPYEEAWNQMLLRRQKARQLEQKINNYLTVPAHKLDSPTMSRARIGSDPLAYEPKEDLPVITIDPA
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: SLC9A1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:200 - 1:500

Images

Immunohistochemistry analysis in human stomach and liver tissues using Anti-SLC9A1 antibody. Corresponding SLC9A1 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human cerebral cortex, kidney, liver and stomach using Anti-SLC9A1 antibody HPA048532 (A) shows similar protein distribution across tissues to independent antibody HPA052891 (B).

Immunohistochemical staining of human stomach shows high expression.

Immunohistochemical staining of human liver shows low expression as expected.

Immunohistochemical staining of human kidney using Anti-SLC9A1 antibody HPA048532.

Immunohistochemical staining of human cerebral cortex using Anti-SLC9A1 antibody HPA048532.

HPA048532-100ul

HPA048532-100ul

HPA048532-100ul