Anti-CHAT Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA048547
Artikelname: Anti-CHAT Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA048547
Hersteller Artikelnummer: HPA048547
Alternativnummer: ATA-HPA048547-100,ATA-HPA048547-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CHAT
choline O-acetyltransferase
Anti-CHAT
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 1103
UniProt: P28329
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GLFSSYRLPGHTQDTLVAQNSSIMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDSTN
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CHAT
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000
Immunohistochemical staining of human caudate nucleus shows strong cytoplasmic positivity in a large neurons.
Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in neuroendocrine cells.
Immunohistochemical staining of human lymph node shows no positivity in lymphoid cells as expected.
Immunohistochemical staining of mouse basal forebrain shows strong cytoplasmic positivity in neuronal cells and fibers.
Immunohistochemical staining of mouse cerebellum shows positivity in a subset of neural fiber endings.
HPA048547
HPA048547
HPA048547