Anti-CHAT Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-CHAT Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA048547
• Supplier Catalog Number: HPA048547
• Alternative Catalog Number: ATA-HPA048547-100,ATA-HPA048547-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human, Mouse
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CHAT

Product Description

choline O-acetyltransferase

Additional Information

Anti-CHAT

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 1103
• UniProt: P28329
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: GLFSSYRLPGHTQDTLVAQNSSIMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDSTN
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: CHAT
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:500 - 1:1000

Images

Immunohistochemical staining of human caudate nucleus shows strong cytoplasmic positivity in a large neurons.

Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in neuroendocrine cells.

Immunohistochemical staining of human lymph node shows no positivity in lymphoid cells as expected.

Immunohistochemical staining of mouse basal forebrain shows strong cytoplasmic positivity in neuronal cells and fibers.

Immunohistochemical staining of mouse cerebellum shows positivity in a subset of neural fiber endings.

HPA048547

HPA048547

HPA048547