Anti-LDHD
Artikelnummer:
ATA-HPA048639
- Bilder (6)
| Artikelname: | Anti-LDHD |
| Artikelnummer: | ATA-HPA048639 |
| Hersteller Artikelnummer: | HPA048639 |
| Alternativnummer: | ATA-HPA048639-100,ATA-HPA048639-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | LDHD |
| lactate dehydrogenase D |
| Anti-LDHD |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 197257 |
| UniProt: | Q86WU2 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | GYSTDVCVPISRLPEIVVQTKEDLNASGLTGSIVGHVGDGNFHCILLVNPDDAEELGRVKAFAEQLGRRALALHGTCTGEHGIGMGKR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | LDHD |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human kidney and testis tissues using Anti-LDHD antibody. Corresponding LDHD RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human kidney shows high expression. |
|
|
Immunohistochemical staining of human testis shows low expression as expected. |
|
|
HPA048639-100ul |
|
|
HPA048639-100ul |
|
|
HPA048639-100ul |
Produktgarantie und fachkundiger Support
