Anti-LDHD
Catalog Number:
ATA-HPA048639
- Images (6)
| Article Name: | Anti-LDHD |
| Biozol Catalog Number: | ATA-HPA048639 |
| Supplier Catalog Number: | HPA048639 |
| Alternative Catalog Number: | ATA-HPA048639-100,ATA-HPA048639-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | LDHD |
| lactate dehydrogenase D |
| Anti-LDHD |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 197257 |
| UniProt: | Q86WU2 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GYSTDVCVPISRLPEIVVQTKEDLNASGLTGSIVGHVGDGNFHCILLVNPDDAEELGRVKAFAEQLGRRALALHGTCTGEHGIGMGKR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | LDHD |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human kidney and testis tissues using Anti-LDHD antibody. Corresponding LDHD RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human kidney shows high expression. |
|
|
Immunohistochemical staining of human testis shows low expression as expected. |
|
|
HPA048639-100ul |
|
|
HPA048639-100ul |
|
|
HPA048639-100ul |
Product Guarantee and Expert Support
